PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GRAS
Protein Properties Length: 587aa    MW: 64718 Da    PI: 5.7119
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30592.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.11.3e-1022295842374
        GRAS   2 velLlecAeavss.gdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                 +e+Ll++Ae+++s gd+  aq +Larl+++ +sp g+p++R+a+yf+eAL+  l++         ++++ ++++ + ++aa+k fse+sP+l+f+++t 
  KFK30592.1 229 TEQLLKAAEVIESgGDTCVAQGILARLNQQlSSPIGKPFERAAFYFKEALHGLLLN--------ASSQTLNPYSLIFKIAAYKSFSEISPVLQFANFTS 319
                 689*********978999**********998************************9........66777778889************************ PP

        GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl.eleeLr 195
                 Nq +le+++g + +HiiDfdi++G+QW++L+q+La R++ +p sl+iT+++sp+++++ el  t+++L++fA+e+++++e++vl   +l+ l +++  +
  KFK30592.1 320 NQSLLESFQGFHNLHIIDFDIGYGGQWASLMQELALRDNTAPlSLKITVFASPTNHDQLELGFTRDNLNHFASEINISLEIQVL---SLDLLgSVSWPN 415
                 **************************************99998****************************************9...555553334446 PP

        GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  +++Ea+aVn++ + ++ +      +s+ + vL++vk+lsP+++v++++ +++++ +F ++++++l+ ++al++sl+a   ++ e+++k+Er+l+++ei
  KFK30592.1 416 SSEKEAVAVNISAASFSNM------PSYLPLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQLVHSLQSHAALLESLDAV-NANLEAMQKIERFLIQPEI 507
                 788*********9776664......788889*********************************************887.5677*************** PP

        GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +++va + +  +  ++ +++W++++ ++GF+pv+ s+++++qa++l+++++++g++ve++++sl+l+W++r+Lv+vSaWr
  KFK30592.1 508 EKLVADRSRP-V--ERPMMTWQAMFLQMGFSPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRRELVAVSAWR 584
                 *******999.5..5567*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.533203564IPR005202Transcription factor GRAS
PfamPF035144.5E-100229584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MPLPFEEFQG WPGISCFSYF SSSSFSDPPP SPLLVGRRKL REEAPSSEPT SVLDSLSPLT  60
TSSSTVSSSH GGHSAVGGGG TPTAISGDVT TDEQCGPIGL GDWEQVPSHD NDHDHEQSIL  120
RLIMGDSQDP SLELNTILRT SSSPVFHDSD YRTLGFGVVD TGFGLDHSVP PLFEEKPHHL  180
PPLLINQSQT HFTHNPALFY NIPSTPPPAK RLNQGPMGYH PDPSKQGITE QLLKAAEVIE  240
SGGDTCVAQG ILARLNQQLS SPIGKPFERA AFYFKEALHG LLLNASSQTL NPYSLIFKIA  300
AYKSFSEISP VLQFANFTSN QSLLESFQGF HNLHIIDFDI GYGGQWASLM QELALRDNTA  360
PLSLKITVFA SPTNHDQLEL GFTRDNLNHF ASEINISLEI QVLSLDLLGS VSWPNSSEKE  420
AVAVNISAAS FSNMPSYLPL VLRFVKHLSP TIIVCSDRGC ERTDLPFPQQ LVHSLQSHAA  480
LLESLDAVNA NLEAMQKIER FLIQPEIEKL VADRSRPVER PMMTWQAMFL QMGFSPVTHS  540
NFTESQAECL VQRTPVRGFH VEKKHNSLLL CWQRRELVAV SAWRCRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3126458437375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287420.10.0hypothetical protein CARUB_v10000626mg
SwissprotO813160.0SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A087GL400.0A0A087GL40_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.6__3689__AT4G00150.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.10.0GRAS family protein